not in ramcachenot in fscache PNW,PNW,PRN,PWO,PBR
query - Top 6 of 6 Rows
  ARTICLEDATEARTICLEDATENOTIMEAUTHORAUTHORIDAUTHORIMAGEBODYCAPTIONCAPTION2IMAGE1IMAGE2JOURNALCODEMAGAZINECOUNTRYMAGAZINENAMENEWS2MISC1IDNEWSASSETTYPESNEWSIDNEWSSTATUSNEWSTYPEIDNEWSTYPENAMEPRIMARYDISCIPLINEIDPRIMARYDISCIPLINENAMERELATEDNEWSIDSLISTROWNUMBERSECTIONIDSECTIONNAMESEOURLTITLESUMMARYSUMMARYALTERNATETITLETITLEALTERNATEVCKEYWORDSWSSDISCIPLINESECTORSLISTWSSPAGENAME
1 2010-08-31 16:46:00.0 20100831 [empty string] 0 [empty string] <p class="Default">The label printer, based in Bury St Edmunds, Suffolk, printed 1.75m Fix-a-Form multipage labels for Rowse Honey Blossom and Organic honey jars.</p> <p class="Default">The marketing push aims to attract 1m more people to the products and bump up sales over the next two years.</p> <p class="Default">Rowse, an existing customer of Denny Bros, chose to use the six-page re-sealable labels die cut and machine-applied to the lids of the hexagonal pots.</p> <p class="Default">The label unfolds to give details of the on-pack offer of an eco shopping bag, said a spokesman for Denny Bros.</p> <p class="Default">"Fix-a-Form was a neat way for us to communicate our exclusive eco bag offer," a spokesman for Rowse Honey added.</p> <p class="Default">"The hexagonal shape of the label was very important and we chose Fix-a-Form as we knew it would be the most effective way to communicate the eco bag and new branding."</p> <p class="Default">Rowse Honey is launching a new range of Supahoneys made with Manuka honey, a new Light &amp; Mild Honey, limited edition honeys and a Beekeeper&rsquo;s Select Honeys.</p> [empty string] [empty string] [empty string] [empty string] PNW en_GB printweek.com 0 [empty string] 1025265 1 1 News 0 [empty string] [empty string] 1 2000 Web (online only story, NOT from printed publication) Denny-Bros-scoops-label-deal-honey-jars Denny Bros is helping to spearhead a £3m promotional campaign for honey by rolling out more than a million labels. [empty string] Denny Bros scoops label deal for honey jars [empty string] [empty string] [empty string] ARTICLE:Denny+Bros+scoops+label+deal+for+honey+jars:1025265
2 2010-08-18 15:16:00.0 20100818 Matt Whipp 3148 TH-Matt-whipp-2.jpg <em>Dream</em>, which is published by River Publishing and printed by St Ives, now offers each dealership a customisable four- or six-page cover section via St Ives' Connected Thinking business.<br /><br />Eight dealers have taken up the pilot, choosing images and uploading their own welcome letter and local news stories via a web interface, as well as choosing a regionalised outside back cover ad.<br /><br />The first issue of the 20pp 240x180mm magazine had a print run of 14,000 and was printed on recycled stock and distributed in July.<br /><br />Honda&rsquo;s marketing communications executive Liz Bojarczuk said: "We hope to create a marketing tool that will introduce new and unique content to dealerships, while also building brand advocacy and extending the customer experience once they leave the dealership - it's a really exciting step forward."<br /><br />The company is now looking at rolling out the versioned magazine on a regular basis from next year. [empty string] [empty string] [empty string] [empty string] PNW en_GB printweek.com 0 [empty string] 1023024 1 1 News 0 [empty string] [empty string] 2 2000 Web (online only story, NOT from printed publication) Honda-offers-dealers-customised-magazine Honda has launched a versioned edition of its customer magazine, Dream, that enables its UK dealerships to include personalised content geared towards their local clients. [empty string] Honda offers dealers customised magazine [empty string] [empty string] [empty string] ARTICLE:Honda+offers+dealers+customised+magazine:1023024
3 2010-08-12 16:53:00.0 20100812 Simon Nias 3153 TH-Simon-Nias.jpg <p>Dialogue Touch is the mobile approval client for Dialogue ES, Dalim's online portal for the production, management, transformation and sharing of digital content.</p> <p>The app allows registered users to navigate projects requiring their feedback, view documents in high resolution, zoom, annotate and measure densities for approval or rejection.</p> <p>Christopher Graf, chief commercial officer at Dalim Software, said: "In a 24/7 business like media and graphic communication, anywhere and anytime availability of services through mobile devices is becoming increasingly important.</p> <p>"With our web-based solutions, and now with Dialogue Touch, we enable our clients to communicate with their users like never before, increasing overall efficiency."<br /><br />Dialogue Touch is available for purchase at http://itunes.com/apps/dialogue</p> [empty string] [empty string] [empty string] [empty string] PNW en_GB printweek.com 0 [empty string] 1022093 1 1 News 0 [empty string] [empty string] 3 2000 Web (online only story, NOT from printed publication) Dalim-launches-mobile-approval-app-Apple-iPhone-iPad Dalim Software has launched a mobile approval app that will allow graphic arts professionals to view and interact with project files remotely on their Apple iPhone and iPad. [empty string] Dalim launches mobile approval app for Apple iPhone/iPad [empty string] [empty string] [empty string] ARTICLE:Dalim+launches+mobile+approval+app+for+Apple+iPhone/iPad:1022093
4 2010-08-11 11:46:00.0 20100811 [empty string] 0 [empty string] The 44pp plus cover magazine replaces its predecessor <em>Imaging</em> and is printed by Gloucestershire-based Severnprint, which was listed among the<em> Sunday Times</em>' Top 50 Green Companies in 2008.<br /><br />The magazine is printed on uncoated FSC-certified 100% recycled stock using vegetable-based inks and <a href="http://www.printweek.com/environment/news/925810/Fujifilm-unveils-next-generation-processless-plate/">Fujifilm's HD Pro-T2 processless plates</a>.<br /><br />It is distributed to more than 5,000 Fujifilm customers, throughout the UK and Ireland, and is supplemented by a monthly email newsletter.<br /><br />Fujifilm marketing communications manager Graham Leeson said: "We wanted to relaunch and resize the magazine to make it stand out from other publications and to prove that it is possible to print an environmentally conscious product that also looks great. We are delighted with the result." Print!: replaces Fujifilm's Imaging magazine Print!: replaces Fujifilm's Imaging magazine 618D6F12-E499-C780-C4AAE43AB01CA0FA.jpg 618D43F9-99C9-D367-AC51C7142AEC9BF8.jpg PNW en_GB printweek.com 0 [empty string] 1021738 1 1 News 0 [empty string] [empty string] 4 2000 Web (online only story, NOT from printed publication) Fujifilm-relaunches-customer-mag Fujfilm has relaunched its customer magazine as a biannual publication under the title Print! with a more environmentally friendly angle. [empty string] Fujifilm relaunches customer mag [empty string] [empty string] [empty string] ARTICLE:Fujifilm+relaunches+customer+mag:1021738
5 2010-08-11 08:00:00.0 20100811 [empty string] 3148 TH-Matt-whipp-2.jpg Alongside eight different covers, each of the versions, which cover Birmingham, Bristol, Manchester, Northern Ireland, Scotland, Wales, Newcastle and London, feature a 16pp section of regionalised editorial.<br /><br />Cond&eacute; Nast UK production director Sarah Jenson said: "Working with Tag and Prinovis Nuremberg, we knew this media first would be challenging but quite achievable if managed carefully. &nbsp;<br /><br />"As well as eight bespoke covers, the tailor-made editorial resulted in 128pp of additional repro to produce within an existing production schedule.<br /><br />"Eight extra sheetfed offset cover plate changes and seven extra web offset text plate changes had to be managed and coordinated with the main gravure print run, as well as extra quality control checks being introduced during printing, binding and bundling to ensure the right cover was bound with the right section. <br /><br />"Finally, there was the organisation of separate coded deliveries, and then it was over to our circulation department."<br /><br /><em>Glamour</em> magazine, which describes itself as a magazine of celebrity gossip, fashion trends, hair and beauty tips, had an ABC of 526,145 for the first half of 2009. Bristol edition of September's Glamour magazine Bristol edition of September's Glamour magazine 6091000C-D39C-85D5-592FF59C7E0AE7EA.jpg 6090E91A-9CF7-C038-9D7606CC6EACA2E2.jpg PNW en_GB printweek.com 0 [empty string] 1021534 1 1 News 0 [empty string] [empty string] 5 2000 Web (online only story, NOT from printed publication) Glamour-magazine-gets-tailor-made-treatment-eight-UK-regions Condé Nast's Glamour women's magazine has regionalised its September edition with eight different versions. [empty string] Glamour magazine gets tailor-made treatment for eight UK regions [empty string] [empty string] [empty string] ARTICLE:Glamour+magazine+gets+tailor-made+treatment+for+eight+UK+regions:1021534
6 2010-08-10 08:00:00.0 20100810 Barney Cox 3184 TH-Barney-Cox2.gif <p>The images exploit the raised surface of UV-cured ink and its different texture to the underlying substrate to reproduce textures that enable the blind to "see" an image by touching it.</p> Textures including cloth and skin, and even the keys of a piano and the strings of a violin have been reproduced by building up the images using multiple files, and up to 12 printing passes. <p>Bilbao-based Estudios Durero used 3A Composites black Dibond as the substrate for the black and white images to ensure the visual and the tactile results stood out. In particular the smooth surface provided the greatest tactile contrast with the ink layers.</p> <p>Printing was carried out using a Durst Rho, which Estudios Durero production manager Ander Soriano said was essential for ensuring precise registration between the different passes.</p> <p>The subjects of the photographs were music and musicians, and the exhibition runs until 12 September.</p> Textured prints help blind experience the images Textured prints help blind experience the images 57A20364-9BB1-03D0-AFE027ECD3A8C487.jpg 57A1E51E-DAC8-4674-38EC3D209AB86B0D.jpg PNW en_GB printweek.com 0 [empty string] 1021085 1 1 News 0 [empty string] [empty string] 6 2000 Web (online only story, NOT from printed publication) Digital-print-produces-textured-photos-blind Estudios Durero has worked with photographer Juan Torre to produce an exhibition of 'images to be touched', which are being shown at the Spanish national blind association (ONCE) Tifologic museum in Madrid. [empty string] Digital print produces textured photos for the blind [empty string] [empty string] Design|Business,Business|Business,Digital|Business,Large/wide+format|Business,Inkjet|Business,Monochrome|Business,Print+Buying|Business,Wide+Format|Business ARTICLE:Digital+print+produces+textured+photos+for+the+blind:1021085