not in ramcachenot in fscache PNW,PNW,PRN,PWO,PBR
query - Top 10 of 10 Rows
  ARTICLEDATEARTICLEDATENOTIMEATTACHMENT1ATTACHMENT2ATTACHMENT3AUTHORAUTHORIDAUTHORIMAGEBODYCALCULATEDIMPORTANCECAPTIONCAPTION2CONTENTTITLEDATEADDEDDISCIPLINEIDSLISTDISCIPLINENAMESLISTIMAGE1IMAGE2IMPORTANCEISSUEDATEISSUEIDISSUEIMAGE1ISSUEIMAGE2ISSUENAMEISSUEPUBLISHEDJOURNALCODELABEL1LABEL2LABEL3LASTEDITEDBYASSTRINGLASTEDITEDBYUSERIDLASTEDITEDONMAGAZINECOUNTRYMAGAZINENAMEMISCCATSMULTIIDSLIST_1MISCCATSMULTIIDSLIST_2MISCCATSMULTIIDSLIST_3MISCCATSMULTINAMESLIST_1MISCCATSMULTINAMESLIST_2MISCCATSMULTINAMESLIST_3NEWS2MISC1IDNEWS2MISC2IDNEWS2MISC3IDNEWS2MISCCATSINGLE1IDNEWS2MISCCATSINGLE1NAMENEWS2MISCCATSINGLE2IDNEWS2MISCCATSINGLE2NAMENEWS2MISCCATSINGLE3IDNEWS2MISCCATSINGLE3NAMENEWSASSETTYPESNEWSIDNEWSKEYWORDSNEWSLINKIDSLISTNEWSNORMALISEDCALCULATEDIMPORTANCENEWSSTATUSNEWSTYPEIDNEWSTYPENAMEORIGINPRIMARYDISCIPLINEIDPRIMARYDISCIPLINENAMEPUBLISHEDDATERELATEDNEWSIDSLISTROWNUMBERSECTIONIDSECTIONNAMESECTORIDSLISTSECTORNAMESLISTSEODESCRIPTIONSEOKEYWORDSSEOTITLESEOURLTITLESTATUSSUMMARYSUMMARYALTERNATETITLETITLEALTERNATEVCKEYWORDSWSSDISCIPLINESECTORSLISTWSSPAGENAME
1 2010-09-03 08:01:00.0 20100903 [empty string] [empty string] [empty string] Barney Cox 3331 [empty string] Using metallic effects, whether that's silvery substrates, inks or foiling, is an established method of polishing up a print job and adding value. Unfortunately, adding value invariably adds cost and complexity. With this in mind, Color-Logic has come up with what it believes is a system that maximises value as cheaply and straightforwardly as possible.<br /><br />The concept is based on the idea that if you print four-colour over silver, be that ink, foil or substrate, you can create a huge palette of metallic colours. In the case of printing over a silver ink, the process can produce hundreds of metallics using a four-colour-plus-silver press.<br /><br />If you're thinking 'that sounds familiar,' you're right. Leeds-based MetalFX offered a similar system until owner Ciba shut it down at the end of 2008, leaving users without support or a source for the silver ink.<br /><br />Color-Logic has emerged to fill that gap, with the expert assistance of MetalFX developer Richard Ainge. Ainge is technical director working with US-based colour technology specialist Mark Geeves, who is sales and marketing director. There is no connection with the old firm, aside from Ainge, who wasn't involved in the decision to close it.<br /><br />"Everyone has this thing with us initially about MetalFX," says Geeves. "But once you get in front of customers to explain, they understand."<br /><br />While some printers may still feel burned by the demise of MetalFX, there are others who point out that CMYK over silver is nothing new. But it's not so much the process itself that's the clever part &ndash; it's the way that process is controlled.<br /><br />"It's the ease of use that's crucial," says Geeves. "Getting the tools right for the designers took a long time."<br /><br />Geeves cites a US printer who produced metallic special effects without Color-Logic. Despite the customer being delighted, the printer only used the process once.<br /><br />"The time and effort made it too costly to do," he says. "The design took weeks and they had to press proof it to<br />verify the colour.<br /><br />"Printers' previous experiences give them a perception that special effects are difficult and expensive. They all have one job they show that they have never produced commercially. Our system takes away the guesswork," claims Geeves.<br /><br />Those tools are a set of plug-ins for Adobe Creative Suite and QuarkXPress that put metallic tints into the colour palettes. When designing, you pick a Color-Logic metallic, just like you would any other spot or special colour. It's the same when making separations in Photoshop, for reproducing metallic subjects the separations are built keeping silver ink out of deep shadows and specular highlights. Beyond that it's possible to use layers, masks and colour pickers to precisely control metallics within photographic images, and to ensure a match with metallic specials.<br /><br />At output, regardless of the number of metallic colours specified, the software converts all the specials down into their CMYK-plus-silver components, creating a five-colour file that can be handled by any workflow or RIP. <p><strong>Swatch what happens</strong><br />Designers can refer to a swatch book supplied by their printer to see what the end result will look like. A set of sample files include examples of the effects possible for text, tints, graphics and photos, plus a swatch with all the 250 colours in the palettes separated out to CMYK-plus-silver. These are used to set up the press(es) and as marketing material.</p> <p>In addition to the 250 process metallic colours you can also create two special effects: Dimensional-FX and Watermark-FX, both of which use a combination of silver tints and solids to create design elements that appear to change colour with the viewing angle, and, when juxtaposed with areas without underlying silver, the colours appear and disappear.<br /><br />While MetalFX was limited to offset litho, and to the application of four-colour process over a silver base ink, Color-Logic is designed more openly to help to tame the combination of metallics and process colour regardless of printing process and substrate. In addition to litho the firm has been working with digital and flexo vendors and at LabelExpo will reveal more, to be followed with further digital tie-ups before the end of the year.<br /><br />It's been assumed that digital and metallic are mutually exclusive, but over the past couple of years the options have opened up. The most obvious is in solvent inkjet where Roland DG, INX and Mimaki have announced metallic inks. <br /><br />Color-Logic was shown working with Roland DG at Ipex. An alternative to a metallic ink on a white substrate is its inverse, using a white ink on a metallic substrate. At LabelExpo, Color-Logic will be working with HP Indigo and Xeikon to show label printing solutions that produce metallic effects by combining metallic films with CMYK and white toner. This white ink and CMYK on a silver substrate technique is applicable for inkjet too.</p> <p><strong>Sparkling standards</strong><br />The firm is working with RIP and workflow vendors to enable their systems to automatically identify and process its files. In the meantime a manual workaround can identify the silver separation, or if using white to create a right-reading negative of the silver, to create the white separation.<br /><br />On-press, the silver is printed first, then the standard inks on top. You can even run to an ISO12647-2 specification, with added sparkle. Ainge says you can print over the silver in standard lay-down order of KCMY or, for a better black, CMYK, for which he recommends knocking out behind the black, and adding a 40% cyan behind.<br /><br />Recommended density for the silver is 0.7D for polarised reading, which the firm recommends, or 0.3-0.35D for status T. Contrary to initial expectations, he says a thinner ink film produces the best results, and quicker drying.<br /><br />Color-Logic offers two inks a standard 'leafing' pigment, and a premium 'non-leafing' pigment, which the firm says retains its lustre when coated or varnished. Although the Color-Logic inks aren't UV-cured, they can be over-printed with UV inks or with a UV-cured varnish.<br /><br />The pigment in the silver ink, is aluminium and, as long as overall coverage doesn't exceed 40%, should be recyclable, which Ainge says wouldn't be the case with conventional gold metallics, which contain bronze that needs to be treated as heavy metal waste. Another benefit of the single silver he adds, is the ability to produce vignettes from silver to gold, which would be impossible with two inks.<br /><br />As with the process inks, paper choice is down to the printer. Ainge recommends experimenting with your house coated, uncoated and silk grades, although a premium stock may provide additional lift. Running sheets from tests can be used as marketing materials and swatches for clients.<br /><br />A Silver Printers licence is $1,495 (&pound;950), which includes the test forms, marketing collateral, unlimited onsite seats of the design software, three seats of design software to offer to clients, two 1kg tins of the premium ink and a year's training and technical support. To check the process works with your kit, a basic Starter Kit with one can of ink and just the test form, is $250.<br /><br />To comply with the terms of the site licence you need to submit test sheets to Color-Logic, after which you will be listed as an approved printer on its website. Designers who want to use the process approach a printer found via the site and buy the software from them for $150.<br /><br />Ongoing costs are an annual support fee for the second and subsequent years of "around 10% of the initial site licence", and the Color-Logic standard silver base ink, which costs &pound;23/kg for the standard and &pound;45/kg for the best. The firm estimates that even with heavy coverage the yield is 2,000 B1 sheets per kg. Color-Logic's own ink prices compare to market rates of &pound;12-&pound;20/kg dependent on volume for leafing ink and &pound;14.40-&pound;26/kg (20-30%) more for non-leafing, which is not an excessive premium to pay for the benefits delivered to the printer and the designer by the system.<br /><br />In conclusion, Color-Logic is offering a valuable tool to add sparkle to print that is affordable and achievable for the designer and the printer.</p> 1940277 [empty string] [empty string] [empty string] 2010-09-01 15:07:18.0 2316 Pre-media CDA24EE7-C261-2F62-0676F8099256D964.jpg CDA22826-DF70-5E6C-843245181FC6DCC2.jpg 5 2010-09-03 00:00:00.0 1142 [empty string] [empty string] [empty string] 1 PRN [empty string] [empty string] [empty string] Chloe Setter via CMS 3 911 2010-09-01 15:12:00.0 en_GB PrintWeek [empty string] [empty string] [empty string] [empty string] [empty string] [empty string] 0 0 0 0 [empty string] 0 [empty string] 0 [empty string] [empty string] 1025646 [empty string] [empty string] 0.00945518330106 1 294 Product of the Week Created via the CMS4 by Chloe Setter 0 [empty string] 2010-09-01 15:07:18.0 [empty string] 1 6151 Product of the Week [empty string] [empty string] [empty string] [empty string] [empty string] Color-Logic-Process-Metallic-Color-System 1 Often considered more hassle than they're worth, this system puts metallics within easy reach, says Barney Cox [empty string] Color-Logic Process Metallic Color System [empty string] [empty string] [empty string] ARTICLE:Color-Logic+Process+Metallic+Color+System:1025646
2 2010-09-03 08:00:00.0 20100903 [empty string] [empty string] [empty string] Nosmot Gbadamosi 3166 [empty string] Demand for in-house bookletmaking led to the development of Horizon's SPF/FC-10, the manufacturer's first entry-level booklet production line, which was unveiled at Ipex in 1992. It formed the backbone of Horizon's booklet kit until it was succeeded by the SPF/FC-20 in 1997.<br /><br />The stitch, fold, and trim machine can be integrated with Horizon's AC, HAC, TC and TAC series collators. In 1996 it was upgraded to the faster SPF/FC-10II that had improved controls, followed by the SPF/FC-11 and then the SPF/FC-20. <br /><br />Alongside this was the SPF/FC-20a bookletmaker, which had offered an operating speed of 4,500 booklets per hour (bph), compared to its predecessor's 2,600bph and featured geared folding rollers and a 10-inch colour touchscreen.<br /><br />"Current-day systems demonstrate a steady, highly automated progression from the SPF/FC-10 prompted by printers demanding faster book production and higher quality. Also the advent of digital print engines meant these automated systems could operate more effectively online," explains Alan Harrison technical director for Intelligent Finishing Systems, the distributor for Horizon in the UK.<br /><br />According to Harrison, developments on the machine were focused on functionality.<br /><br />"As it was manual the SPF/FC-10 took longer to set up and required more skilled operators. Automation has been increasingly added to upgraded models offering benefits such as job memory storage and JDF compatibility," explains Harrison.<br /><br />The system takes sheets from the collator in page order with the cover sheet on top. They are then fed into a jogger where the book block is jogged on three sides before being stitched.<br /><br />"This frictionless operation prevents any scuffing to the centre pages. The block is then fed into the folding area and there are registration guides that maintain a consistent fold position to the wire stitching," says Harrison.<br /><br />The stitched book then exits through nipping rollers to flatten it and is transferred to the fore-edge trimmer where it is clamped along the spine and fore-edge before trimming. <p><strong>Secondhand source</strong><br />Optional extras include long delivery conveyors, a pre-set kicker on the delivery system and the ability to fit four stitching heads instead of the normal two. IFS will part-exchange used models, while Used Horizon Direct (UHD) is a good port of call for secondhand machines.<br /><br />"The world market for Horizon used equipment is very buoyant," according to Harrison.<br /><br />All spare parts for Horizon machines are available from UHD and IFS and all equipment is supported throughout its lifetime.<br /><br />"Spare parts, including those for the first friction collator sold in the UK in 1981, are still available from Horizon's headquarters in Japan," says Harrison.<br /><br />IFS has 16 service engineers and technical support staff based around the UK. UHD operates its own team of specialist engineers to refurbish and rebuild Horizon equipment.<br /><br />The SPF/FC-10 is no longer available new, but the SPF/FC-20 costs around &pound;26,500 while the SPF/FC-20a is &pound;36,000.<br />Price for a fully refurbished SPF/FC-1011, including delivery and installation and three months comprehensive warranty, is around &pound;10,000. But note they are generally sold with MC-8/80 collators. As with all used machines check the usual things like wear and tear and service history.</p> <p><span style="text-decoration: underline;">SPECIFICATIONS</span><br /><strong>Max sheet size</strong> 330x470mm<br /><strong>Min sheet size</strong> 210x149mm<br /><strong>Stitch thickness&nbsp;</strong>4mm<br /><strong>Production speed</strong> 2,600bph<br /><strong>Price </strong>Used SPF/FC-1011: around &pound;10,000<br /><strong>What to look for</strong></p> <ul> <li>General wear and tear</li> <li>Service history</li> </ul> 1940277 Horizon SPF/FC-10 Horizon SPF/FC-10 [empty string] 2010-09-01 14:28:24.0 2312 Post-press CD7CC67E-EF69-9401-74E5FC16408F967A.jpg CD7CB3D2-C9B5-7818-14C71DFF496E19FE.jpg 5 2010-09-03 00:00:00.0 1142 [empty string] [empty string] [empty string] 1 PRN [empty string] [empty string] [empty string] Chloe Setter via CMS 3 911 2010-09-01 14:30:00.0 en_GB PrintWeek [empty string] [empty string] [empty string] [empty string] [empty string] [empty string] 0 0 0 0 [empty string] 0 [empty string] 0 [empty string] [empty string] 1025607 [empty string] [empty string] 0.00945518330106 1 296 Tried & Tested Created via the CMS4 by Chloe Setter 0 [empty string] 2010-09-01 14:28:24.0 [empty string] 2 6154 Tried & Tested [empty string] [empty string] [empty string] [empty string] [empty string] Horizon-SPF-FC-10 1 Now superseded by more modern, automated systems, this bookletmaker once formed the core of the company's offering says Nosmot Gbadamosi [empty string] Horizon SPF/FC-10 [empty string] [empty string] [empty string] ARTICLE:Horizon+SPF/FC-10:1025607
3 2010-08-20 10:24:00.0 20100820 [empty string] [empty string] [empty string] Adam Hooker 3163 [empty string] With the Eurobind Pro, Heidelberg has entered into a new arena where it will find itself facing off against some unfamiliar foes. The 6,000 cycles per hour (cph) Eurobind fits into a niche that has historically been dominated by the likes of Muller Martini and Kolbus. From the outside, it would seem like a brave departure but it's one that the manufacturer is confident will pay off.<br /><br />The Eurobind Pro model is the follow up to the 600, but it is around 50% faster than its predecessor thanks to its longer build, which accelerates the paper through the in-feeder.<br /><br />Its price point is around the &pound;700,000 mark, depending on specifications &ndash; as is usual with these machines, the cost of the Eurobind Pro can be stripped back to something more affordable if you're working on a reduced budget.<br /><br />For your money, you get a gatherer, the binder itself, a cooling tower and a three-knife trimmer at the end, although the binder can be sold as a separate entity if you already have the requisite pre- and post-processing kit.<br /><br />Heidelberg's gatherer runs at 6,000cph, allowing it to keep up with the binder, and it features one to eight gathering modules, with four feeders per module. It also has self-learning missing and double-sheet detection fitted as standard and can be upgraded to include barcode reading or image recognition technology. <p><strong>Reduced marking</strong><br />The three-knife trim supplied as part of the system is a Eurotrim 4000. It can perform 600-4,000 cuts per hour, with maximum book block widths of 320mm and a maximum height of 450mm. An infeed gripper lifts the product to ensure the material is not marked or damaged when it is fed into the cutting cell.<br /><br />However, the most important bit of the machine is, of course, the binder itself, which Heidelberg is lauding as<br />the last word in automation that boasts agenda-setting makeready performance.<br /><br />"We can go good sheet to good sheet in three to four minutes," explains Heidelberg UK marketing manager for post-press Mark Hogan. "Nowadays, you simply can't have a perfect binder sat around for 45 minutes during the makeready."<br /><br />Makeready set-up can be done from one point on the entire system, with each machine featuring a touchscreen control panel. This means that the operator can make changes to the entire system from one place. Aside from slight changes on the trimmer, which may have to be made by hand, the entire system is automated.</p> <p><strong>Downtime decrease</strong><br />The machine also uses separate servo-drives for each individual module, up to a maximum of eight, with four feeders each. This means that modules can be prepared for the next job while the current job is still running, further reducing downtime between set-ups.<br /><br />Automation also runs into the adhesive application, where a laser system is used to ensure that no more than the optimum amount of glue is used. Operators can see in real time the level of glue applied, book-to-book, through a readout. If the glue level falls below or exceeds a set level, the machine will stop.<br /><br />While this is not a system that is particularly important for hot-melt gluing, for PUR binding &ndash; where the adhesive is a lot more costly &ndash; it can be crucial.<br /><br />It uses a two-roller application system for hotmelt or PUR adhesive. It also offers a third option, closed PUR nozzle application, for precise application.<br /><br />There is also a side hotmelt gluing system, equipped with two oblique gluing disks, controlled doctor blades and a thread melting device.<br /><br />Further assistance to ensure that the level of glue being applied is appropriate comes from the spine preparation system &ndash; another factor that Hogan believes makes the machine stand out from the crowd.<br /><br />"Just because PUR glue is a better quality doesn't mean you can just slap it on and get a better quality book," he explains. "The strength of the clamp and the quality of the spine preparation is crucial in producing a really good bind."<br /><br />Any company that invests in the machine will need at least two operators to run it, owing to its speed. A bindery/trimmer operator and someone working the feeder is imperative, while a third "helper" to muck in at either end, depending on what stage the printing is at, would also be wise, according to Hogan.<br /><br />Had the Eurobind Pro been launched a few years ago, its appeal would almost certainly have been restricted to high-volume offset houses or trade finishers.<br /><br />However, with run lengths coming down further and the short makeready time that this particular machine offers addressing the demands of the modern printing industry for an ever-faster turnaround of work, Heidelberg believes that the world is its oyster.</p> <p><strong>All-market option</strong><br />"Because of the makeready it is possible to run jobs of 100 books and below," says Hogan. "It has been looked at by companies specifically as a digital finishing solution."<br /><br />There are around 30 Eurobind Pro machines installed worldwide at the moment and the model is currently available in the UK, although it has yet to be given its official 'launch', which will take place in September.<br /><br />Thanks to the trying market conditions, binders of this size are not exactly flying off the shelf at the moment &ndash; indeed it's highly unlikely that more than five or six 5,000-7,000cph binders will be sold every year in the UK across all manufacturer ranges.<br /><br />However, with the Eurobind Pro, Heidelberg has positioned itself aggressively into this market and Hogan for one is confident that the machine will prove to be a resounding success.<br /><br />"We would certainly be aiming to clean up 50% of the market in this size," he concludes.<br /><br />It will be interesting to see how the machine is received in the UK, as an alternative to long-established models. The Eurobind can be easily fitted to a Heidelberg press, so companies looking to jump on the short-run book band wagon can now go to Heidelberg for a complete solution. <br /><br />Frustra&shy;tingly, for Heidelberg, as it is with all manufacturers in the current climate, the success of the machine will depend on companies being brave enough to spend big and lenders being brave enough to back them. If both of these things happen, there is no reason why the machine can not be a success. Indeed, if these companies are ready to push the button on investment, Heidelberg's launch date could be perfect.</p> <p><span style="text-decoration: underline;">SPECIFICATIONS</span><br /><strong>Speed</strong> 6,000cph<br /><strong>Clamps</strong> 19 or 24<br /><strong>Max block width</strong> 320mm<br /><strong>Max block height</strong> 450mm<br /><strong>Max block thickness</strong> 60mm<br /><strong>Signature grammage</strong> 60&ndash;170gsm<br /><strong>Price</strong> &pound;700,000<br /><strong>Contact</strong> Heidelberg UK, 020 8490 3500, www.uk.heidelberg.com</p> <p><span style="text-decoration: underline;">ALTERNATIVES</span><br /><br /><strong>Muller Martini Acoro</strong><br />Two different Acoro models are available, the A5 and the A7, running at 5,000 and 7,000 cycles per hour respectively.<br />The A5 has 16-20 clamps, while the A7 comes with 22-28. Both are available with PUR glue and hot-melt.<br /><strong>Speed</strong> 5,000-7,000cph<br /><strong>Clamps</strong> 20-28<br /><strong>Max block width</strong> 320mm<br /><strong>Max block height</strong> 430mm<br /><strong>Max block thickness</strong> 60mm<br /><strong>Signature grammage </strong> n/s<br /><strong>Price &pound;</strong>700,000-&pound;900,000<br /><strong>Contact</strong> Muller Martini UK, 0844 875 4590, www.mullermartini.co.uk</p> <p><strong>Kolbus KM600 Ratiobinder</strong><br />The KM600 Ratiobinder has some pedigree. It is a development on a design that dates back more than 20 years. Similarly to Heidelberg, Kolbus is keen to push the machine's makeready, which the company says can be completed in around 30 seconds.<br /><strong>Speed</strong> 7,000cph<br /><strong>Clamps</strong> 21<br /><strong>Max block width</strong> 320mm<br /><strong>Max block height</strong> 460mm<br /><strong>Max block thickness</strong> 60mm<br /><strong>Signature grammage</strong> n/s<br /><strong>Price</strong> &pound;700,000<br /><strong>Contact</strong> Kolbus UK 01908 317878, www.kolbus.co.uk</p> <p><strong>Wohlenberg City E/Master E</strong><br />Wohlenberg has two machines that would be relevant to this size of the machine, the City E and Master E. The City E has 15 clamps and will run at 4,000-6,000cph, while the Master E has 18 clamps and runs at 6,000-8,000 cph.<br /><strong>Speed</strong> 4,000&ndash;8,000cph<br /><strong>Clamps</strong> 15-18<br /><strong>Max block width</strong> 320<br /><strong>Max block height</strong> 435<br /><strong>Max block thickness</strong> 62mm<br /><strong>Signature grammage </strong> 70gsm<br /><strong>Price</strong> from &pound;650,000<br /><strong>Contact</strong> Friedheim 0845 026 2001, www.friedheim.co.uk</p> 1939609 [empty string] [empty string] [empty string] 2010-08-20 10:27:03.0 2312 Post-press 8EDB64AB-0FBF-4B25-8C00C176B4D9C131.jpg 8EDB4D5A-0E47-EE30-5BB5D2502FF416B4.jpg 5 2010-08-20 00:00:00.0 1138 [empty string] [empty string] [empty string] 1 PRN [empty string] [empty string] [empty string] Chloe Setter via CMS 3 911 2010-08-20 10:37:00.0 en_GB PrintWeek [empty string] [empty string] [empty string] [empty string] [empty string] [empty string] 0 0 0 0 [empty string] 0 [empty string] 0 [empty string] [empty string] 1023307 [empty string] [empty string] 0.00945192806356 1 294 Product of the Week Created via the CMS4 by Chloe Setter 0 [empty string] 2010-08-20 10:27:03.0 [empty string] 3 6151 Product of the Week [empty string] [empty string] This binder is breaking new ground for the manufacturer and if it has got its timing right, Adam Hooker says it could prove a popular option for a number of sectors Heidelberg Eurobind Pro Heidelberg Eurobind Pro Heidelberg-Eurobind-Pro 1 This binder is breaking new ground for the manufacturer and if it has got its timing right, Adam Hooker says it could prove a popular option for a number of sectors [empty string] Heidelberg Eurobind Pro [empty string] [empty string] [empty string] ARTICLE:Heidelberg+Eurobind+Pro:1023307
4 2010-08-20 09:55:00.0 20100820 [empty string] [empty string] [empty string] Nosmot Gbadamosi 3166 [empty string] K olbus has been building bookbinding machines at its headquarters in Rahden, Germany, since 1900, but it didn't launch it's first three-knife cutter, the HD 150, until 1982.<br /><br />Targeted at high-volume printers using multiple binding lines, as its name implies, the machine was capable of trimming three sides of a book block at the same time. According to Greg Bird, sales manager for Kolbus UK, the HD 150 was the first machine of its type to feature scoring knives.<br /><br />"Scoring the product before being trimmed prevented nipping of the covers," explains Bird. <p><strong>Dual versions</strong><br />Today, there are two versions of the machine: the 150.B and the HD 153.P. Introduced in 1998, the 150.B was an entry-level, simplified version of the trimmer. This was followed by the introduction of the 1503P at Ipex 2006. The 'P' stood for programmable, with the model fitted with Copilot and featuring a central adjustment console.<br /><br />Faced with stiff competition from Muller Martini models, Kolbus focused its attention on developing the way books were handled on the machine from the in-feed to the delivery.<br /><br />To this end, the machine picks up and carries the book, ensuring there is no dragging on the belts and, therefore, avoiding marks and scuffs. Once at the trimming station, sidelays support the spine and hold it firmly in position, preventing chipping or tearing.<br /><br />The machine can achieve simultaneous trimming of multiple copies up to 80mm thick. The 153.P can also be linked to other controls for printers running more than one three-knife trimmer for two-up book production.<br /><br />The trimmer can take pre-set information from an MIS or from the bindery, which, according to the company, speeds up makereadies and means printers don't have to replicate information on the trimmer.<br /><br />Meanwhile, the in-feed can feed continually into a pile, or you can have a counter stacker operation where the machine will count three books and then feed, rather than just feeding from the bottom.<br /><br />Since it launched, Kolbus has sold more than 700 of the 150 range worldwide. The manufacturer does not sell used machinery direct, but will happily part-exchange old models. Kolbus has eight engineers in the UK and is supported by an additional team of engineers at its headquarters in Germany. Service contracts are bespoke and tailored to each customer.<br /><br />When looking for a used machine, check the number of cycles and the number of books the machine has produced. Also make sure the machine has been well-maintained.<br /><br />Used models that are five years old will usually command 50% of the new price.</p> <p><span style="text-decoration: underline;">Specifications</span></p> <p><strong>Max size</strong> 310x400x80mm<br /><strong>Max stack height</strong> 80mm<br /><strong>Speed</strong> Up to 6,000 cuts per hour<br /><strong>Max front off-cut width</strong> 40mm<br /><strong>Max head and tail off-cut width</strong> 50mm<br /><strong>Footprint</strong>&nbsp; 2.5x4.2m<br /><strong>Weight</strong> 5.2 tonnes<br /><strong>Price </strong>New: &pound;185,000, five-year-old used model: &pound;92,500<br /><strong>What to look for</strong></p> <ul> <li>Wear and tear</li> <li>Number of cycles and products</li> </ul> 1939608 Kolbus HD 150 Kolbus HD 150 [empty string] 2010-08-20 09:58:48.0 2312 Post-press 8EBADF9A-A027-2A9A-41C9698F6E8A08E8.jpg 8EBACDB8-CB25-9FC4-EAAE6CA27E112F12.jpg 5 2010-08-20 00:00:00.0 1138 [empty string] [empty string] [empty string] 1 PRN [empty string] [empty string] [empty string] Chloe Setter via CMS 3 911 2010-08-20 10:12:00.0 en_GB PrintWeek [empty string] [empty string] [empty string] [empty string] [empty string] [empty string] 0 0 0 0 [empty string] 0 [empty string] 0 [empty string] [empty string] 1023296 [empty string] [empty string] 0.00945192319045 1 296 Tried & Tested Created via the CMS4 by Chloe Setter 0 [empty string] 2010-08-20 09:58:48.0 [empty string] 4 6154 Tried & Tested [empty string] [empty string] The firm's first three-knife trimmer was suited to high-end publications with its attention to faultless book transfer, finds Nosmot Gbadamosi Kolbus HD 150, three-knife trimmer Kolbus HD 150 Kolbus-HD-150 1 The firm's first three-knife trimmer was suited to high-end publications with its attention to faultless book transfer, finds Nosmot Gbadamosi [empty string] Kolbus HD 150 [empty string] [empty string] [empty string] ARTICLE:Kolbus+HD+150:1023296
5 2010-08-13 08:00:00.0 20100813 [empty string] [empty string] [empty string] Barney Cox 3331 [empty string] With the 550XT, Oc&eacute; has rounded off its hugely successful Arizona line of UV-cured flatbed machines with its largest and fastest machine to date. The first of the 550 series, the smaller 1.25x2.5m format 550GT, was launched at the beginning of the year with double the throughput of the 350GT, and is now joined by the 550XT with its 3x2.5m bed.<br /><br />Speed is the biggest difference between the 350 series and 550 series and the improved performance has been driven by a new printhead configuration and new heads with double the number of nozzles. There are some mechanical differences under the hood, but the only outwardly visible difference is the larger print carriage holding the heads.<br /><br />"Other than that it's the same size and quality as our earlier machines," says Oc&eacute; Display Graphics marketing manager Derek Joys.<br /><br />Both have at least twice the throughput of the equivalent 350 series and in some modes, notably fine art, it approaches a three-fold increase, rising from 9m2/hr to 24m2/hr.<br /><br />Printing with white is where the speed increase is really apparent, and at 15m2/hr is "practically the same 'production' speed as the old Arizona was without white," says Joys.<br /><br />Flat out, in 'express' flatbed mode, and on a limited set of substrates, it can hit 67m2/hr. However, this mode is more appropriate for billboards, mesh and far-viewed banners produced using the roll-to-roll option, in which case the speed falls to 50m2/hr.<br /><br />Materials handling also makes a big difference to speed. The 3.05x2.5m format of the XT is not just so that it can handle 3x2m boards with room to spare, the bed is configured as two separate beds, allowing printing on one side and media loading on the other. In this mode, two 1.25x2.5m (8x4ft) boards can be handled at a time, with a real-world production figure of 110 boards per eight-hour shift.<br /><br />The speed increase takes the Arizona into a new sector going head-to-head with the likes of Inca, Vutek, HP Scitex and Durst with the higher productivity flatbeds.<br /><br />"If you go faster it opens up new opportunities," says Joys. "Albeit in a smaller sector of the market."<br /><br />You could accuse Oc&eacute; of being greedy in going up into this market, when, with more than 2,000 installations of the Arizona UV flatbed series since its launch in 2006, it has become the most successful UV flatbed in the world, with more than 40% market share.<br /><br />With that sort of success it's not surprising that the Arizona has become the Heidelberg Speedmaster 74 of the UV flatbed market &ndash; a sector-defining everyman's machine &ndash; to the extent that rivals have launched machines to challenge its quality, throughput, price or a combination of those.<br /><br />Quality is described as "equivalent to 1,440dpi", although Joys won't disclose the native resolution of the printheads or who makes them.<br /><br />"I don't even know who makes them," he says. "It's the way we drive them that makes the machine."<br /><br />The firm's VariaDot technology works with the greyscale printheads to produce seven different dot sizes from six to 42 picolitres.<br /><br />"Native resolution of the head is largely academic and even if you analysed the image it would be hard to tell," he says. "Dots per inch is to some extent meaningless with the precise placement and multiple drop sizes." <p><strong>Well toned</strong><br />VariaDot also simplifies the design and operation of the machine by ensuring smooth tonality, especially in the light quartertones, without having to resort to light cyan and light magenta inks. Oc&eacute; argues that it also minimises ink consumption as well as reducing the number of heads and ink lines, with consumption of 8ml/m2, which with ink at &pound;118/litre provides running costs (excluding substrate) of a maximum of 94p/m2 even with heavy coverage.<br /><br />"Because UV ink sits on the surface, consumption is consistent regardless of the substrate, unlike solvents," he says.<br />The white, which is taken on 90% of new machines, and is also retrofittable, can be printed in any order with the other colours, which is controlled by the Onyx ProductionHouse RIP. With coloured substrates, a white can be laid down to print four-colours onto, while for clear materials, white can be used for backlit work or white with a black between can be used for work to be viewed from both sides.<br /><br />"The permutations for printing white and colour are almost limitless," says Joys. "Flood, spot and layer-by-layer."<br /><br />The inks themselves are Fujifilm's formulation &ndash; a fitting bit of share and share alike, as it sells the Arizonas under its Acuity label. Two formulations are available, the original 'hard' 255 version and the more recent 'flexible' 256 inks, which are formable and resist edge chipping when being cut or routed. Both types can be used for rigid or flexible materials, and Joys says most users opt for one type and stick to it.</p> <p><strong>More substrate options</strong><br />Another development on the 550 series is in the UV curing system. Although it uses traditional mercury vapour lamps, rather than newfangled LED UV technology, Oc&eacute; has found a way to get more UV onto the substrate to cure the inks, while reducing the heat, widening the range of substrates that can be handled to include more that are sensitive to heat and prone to warping and or yellowing.<br /><br />While the bigger print carriage may be the most obvious difference between the 550 and its predecessors other changes mean that you can't upgrade a 350 to the 550 specification. Oc&eacute; doesn't see that as a problem, though; it offers a "competitive" option for swapping out older machines for new ones, and there is strong demand for second-user units, which Oc&eacute; supplies. Joys cites the original Arizona 250 series, which can be picked up for &pound;50,000-&pound;60,000. He also points out that some users looking for increased throughput prefer the flexibility of two slower machines, hence the continuation of the 350 series, which ranges from &pound;85,000 for the 350GT to &pound;145,000 for the 350XT, and the availability of the smaller (1.25x2.5m) 550GT, which starts at &pound;145,000.<br /><br />Of course, however fast, no machine is any good if it spends most of its time up on bricks. Up-time is claimed to be 97%, and should there be a problem, Joys promises a prompt service from Oc&eacute;'s customer support team and 16 UK-based engineers. Response time is a guaranteed eight hours, which he says realistically means next-day. But before an engineer arrives they will phone the customer to talk through the problem to see if production can continue and to ensure they have the right spares when they arrive.</p> <p><span style="text-decoration: underline;">SPECIFICATIONS</span><br /><strong>Max size</strong> 3.05x2.5m<br /><strong>Max speed</strong> 66m2/hr<br /><strong>Max material thickness</strong> 51mm<br /><strong>Resolution/quality</strong> equivalent to 1,440dpi<br /><strong>Colours</strong> CMYK, optional white<br /><strong>RIP/workflow</strong> Onyx ProductionHouse<br /><strong>Type</strong> flatbed with roll-to-roll as an option<br /><strong>Price </strong>basic machine: &pound;167,000, with white and roll-to-roll options: &pound;197,000<br /><strong>Running cost</strong> 94p/m2<br /><strong>Contact</strong> Oc&eacute; UK 0870 600 5544 <a href="http://www.oce.com" target="_blank">www.oce.com</a></p> <p><span style="text-decoration: underline;"><br />ALTERNATIVES</span><strong><br />Agfa Anapurna M2050</strong><br />Lacking the extra size that enables the Arizona to handle two 1.25x2.5m boards at a time, but with a lower price.<br />Max size 2.05x3m<br />Max speed 48m2/hr<br />Price &pound;120,000<br />Contact Agfa UK 020 8231 4929 www.agfa.com</p> <p><strong>EFI Rastek T1000</strong><br />Baby brother to the Vutek range with a lower price point and a smaller bed for firms looking to get into UV flatbed.<br />Max size 1.32x2.49m<br />Max speed 37m2/hr<br />Price &pound;105,000<br />Contact Your Print Supplies 0191 256 6889<br />www.ypsprintsupplies.co.uk</p> <p><strong>EFI Vutek QS220</strong><br />The QS220 is the baby of the Vutek range, but as they are industrial strength machines, that's a big baby.<br />Max size 1.6x3.2m<br />Max speed 70m2/hr<br />Price &pound;124,000 (&euro;149,000)<br />Contact EFI Vutek 07887 842786 www.efi.com/vutek</p> <p><strong>Fujifilm Acuity Advance HS X2</strong><br />As it's the same chassis, with the same ink, it's the closest direct rival to the Arizona.<br />Max size 3.05x2.5m<br />Max speed 66m2/hr<br />Price &pound;160,000<br />Contact Fujifilm UK 01234 245245 www.fujifilm.com</p> <p><strong>HP Scitex FB700</strong><br />Designed to go head-to-head with the Arizona, it supports wider (2.5m), heavier (80kg) rolls and thicker (63mm) boards.<br />Max size standard: 1.22x2.5m<br />extension table: 3.05x2.50m<br />Max speed 80m2/hr<br />Price &pound;99,000<br />Contact HP 07825 725496 www.hp.com</p> <p><strong>Meital 302D</strong><br />This is the closest Meital to the 550XT. Single table, slower and faster versions, make this a flexible machine.<br />Max size 1.25x2.5m<br />Max speed 75m2/hr<br />Price &pound;245,000<br />Contact DPI 01332 856355 www.dpi-uk.com</p> <p><strong>Mimaki JFX-1631</strong><br />The mimaki offers a higher quality than the Arizona with optional varnish, as well as white ink.<br />Max size 1.6 x 3.1m<br />Max speed 13m2/hour<br />Price &pound;115,000<br />Contact Hybrid Services 01270 501900<br />www.hybridservices.co.uk</p> 1939269 Océ: Arizona 550XT flatbed Océ: Arizona 550XT flatbed [empty string] 2010-08-11 14:17:59.0 2311,2533 Digital,Wide Format 6152BB37-ABA2-B6C6-48185DF0DF1EEFF2.jpg 6152A81E-F5CC-0C19-AAD3F967EF47D0D6.jpg 5 2010-08-13 00:00:00.0 1132 [empty string] [empty string] [empty string] 1 PRN [empty string] [empty string] [empty string] Chloe Setter via CMS 3 911 2010-08-11 14:25:00.0 en_GB PrintWeek [empty string] [empty string] [empty string] [empty string] [empty string] [empty string] 0 0 0 0 [empty string] 0 [empty string] 0 [empty string] [empty string] 1021774 Wide Format [empty string] 0.00945027120616 1 294 Product of the Week Created via the CMS4 by Chloe Setter 0 [empty string] 2010-08-11 14:17:59.0 [empty string] 5 6151 Product of the Week [empty string] [empty string] The latest iteration of this sector-defining press breaks into new markets and competes with the very best, reports Barney Cox Océ, Arizona 550Xt, flatbed printer Océ Arizona 550XT OcE-Arizona-550XT 1 The latest iteration of this sector-defining press breaks into new markets and competes with the very best, reports Barney Cox [empty string] Océ Arizona 550XT [empty string] [empty string] [empty string] ARTICLE:Océ+Arizona+550XT:1021774
6 2010-08-13 08:00:00.0 20100813 [empty string] [empty string] [empty string] Nosmot Gbadamosi 3166 [empty string] <p>Edale&rsquo;s roots in narrow web production can be traced back as far back as the 1950s. Since then it has continued to develop new machines to ensure it remains competitive in today&rsquo;s cut-throat market. Indeed, today, according to Jeremy Westcott, head of sales and marketing at Edale, it has five or 10 new machines in the launch pipeline.<br /><br />One of the firm&rsquo;s most significant launches came just over a decade ago. In 1999 Edale decided to develop a modular range which could challenge rival Mark Andy&rsquo;s 2200. When launched, the B range of narrow web flexographic presses, offered two web widths of 250mm and 330mm. <br /><br />Although the press continued to give customers a choice in web widths, a series of minor changes led to the machine being re-branded the Beta in 2001. <br /><br />Designed predominantly for label printing applications, such as food, wine, pharmaceutical, and technical &lsquo;peel and read&rsquo; labels, some printers have broadened its applications to include clothing tags and tickets produced on thicker substrates such as light board. <br /><br />The standard model comes with one die-cutting station and one sheeting station, offering reel-to-reel or reel-to-end production and a &lsquo;web-up&rsquo; design. This means the machine&rsquo;s drying units are located above the printheads, rather than below, to avoid the risk of ink drying on the plates and aniloxes and to provide better web visibility, thereby making jobs easier and quicker to set up and, according to the manufacturer, helping to reduce waste. <br /><br />The press can incorporate both UV drying and infrared, for water-based inks. Because the machines were designed to be modular, printers can build up their own specifications and retrofit a number of different options onto the press. These include quick job change, web cleaning, rotary screen-printing, slitting, hot and cold foiling and the capability to produce personalised labels with a digital press. Laminating for both UV and standard print is another option. <br /><br /><strong>Winding options</strong><br />New versions of the machine are currently being developed with a wider range of sizes for rewinds and unwinds. The machine&rsquo;s servo infeed tension control will also come as standard when the new formats are unveiled in a couple of months&rsquo; time. <br /><br />Edale sells secondhand machines direct, but this is often done when a customer is looking to part-exchange their older model for a newer press. The typical price for an eight-year-old six- to eight-colour Beta 250 is around &pound;80,000, which is around 40% of the price of new models. A 330mm-web-width eight-colour UV Beta will cost upwards of &pound;200,000. <br /><br />Edale has four engineers in the UK and service contracts are arranged into bronze, silver and gold packages. The bronze package offers an annual preventative maintenance while silver has the added benefit of further discounts on spare parts. Edale&rsquo;s gold service offers additional remote software support. <br /><br />When looking to buy a used press, check the usual things like service history. It&rsquo;s also a good idea to get the manufacturer to check it over so you can be sure of what will need to be replaced and the costs associated with this.</p> <p><span style="text-decoration: underline;">SPECIFICATIONS:</span></p> <p><strong>Max number of print stations </strong>14<br /><strong>Max number of die stations</strong> 3<br /><strong>Web width</strong> 250mm/330mm<br /><strong>Max print width </strong>246mm/326mm<br /><strong>Max mechanical speed </strong>150m/min<br /><strong>Max unwind capacity</strong> 800mm<br /><strong>Max rewind capacity</strong> 900mm<br /><strong>Footprint (eight-colour, 330mm web width)</strong> 15m2<br /><strong>Weight (eight-colour, 330mm web width)</strong> 4,500 kg<br /><strong>Price </strong><br />&nbsp;&nbsp; &nbsp;New (eight-colour, 330mm web width): &pound;200,000+<br />&nbsp;&nbsp; &nbsp;Used eight-year-old 250, six/eight colours: &pound;80,000<br /><strong>What to look for</strong></p> <ul> <li>Service history</li> <li>General wear and tear</li> </ul> <p><br /><br /><br /></p> 1939269 [empty string] [empty string] [empty string] 2010-08-11 10:35:03.0 2320 Presses 60841614-0EAD-C806-9B67146E890EDB4C.jpg 608402AB-F540-D670-31C873D3FC729E51.jpg 5 2010-08-13 00:00:00.0 1132 [empty string] [empty string] [empty string] 1 PRN [empty string] [empty string] [empty string] Chloe Setter 911 2010-08-11 14:34:00.0 en_GB PrintWeek [empty string] [empty string] [empty string] [empty string] [empty string] [empty string] 0 0 0 0 [empty string] 0 [empty string] 0 [empty string] [empty string] 1021699 Presses [empty string] 0.00945027120616 1 296 Tried & Tested Created via the CMS4 by Chloe Setter 0 [empty string] 2010-08-11 10:35:03.0 [empty string] 6 6154 Tried & Tested [empty string] [empty string] A long history of constant development has put Edale's Beta at the forefront of narrow web technology, discovers Nosmot Gbadamosi Edale Beta, narrow web press Tried & Tested: Edale Beta 250/330 Edale-Beta-250-330 1 A long history of constant development has put Edale's Beta at the forefront of narrow web technology, discovers Nosmot Gbadamosi [empty string] Edale Beta 250/330 [empty string] [empty string] [empty string] ARTICLE:Edale+Beta+250/330:1021699
7 2010-08-06 08:00:00.0 20100806 [empty string] [empty string] [empty string] Barney Cox 3331 [empty string] <hr /> <p>When it comes to developing dotmeters, Centurfax has form &ndash; in a good way. Back in the late 1990s, when CTP was new, it was one of a brace of British firms, along with Laurie Mullaney Associates (LMA), that led the way in developing measuring instruments for plates.</p> <p>Fast forward a dozen years and the two firms have joined forces to introduce a new dotmeter, which Centurfax sells as the EasyDot. It&rsquo;s LMA&rsquo;s hardware with Centurfax&rsquo;s software and firmware.</p> <p>The EasyDot is an easy-to-use device that enables you to measure dot percentage on plates. Line the measuring target up, press the case down, wait a second or so and there&rsquo;s your reading. That&rsquo;s it.</p> <p>"Most users don&rsquo;t want or need the more sophisticated features such as dot size, screen ruling and angle," says Paul Foster, managing director of UK reseller Ripware. "As long as you know your dot gain and as long as it&rsquo;s consistent you, only need to take a couple of readings to know that your plates are OK."</p> <p>Any plate with a visible image can be read, which means all processed plates and several no-process plates, including Presstek, Agfa&rsquo;s Azura and Fuji&rsquo;s Pro-V, are all suitable for the product. However, those that develop on press, such as Fuji&rsquo;s Pro-T and the Kodak Thermal No-Process Plate, can&rsquo;t be read.</p> <p>Some rival devices claim that they can read the Fuji plates, with the aid of a special fluid to reveal the image &ndash; presumably, this would work in the same way for the EasyDot. As for those devices that claim to read the image prior to development, Foster questions how the user would find the location of the patches to read.</p> <p>&nbsp;</p> <p><strong>Added specifications</strong></p> <p>If you want access to more sophisticated tools than just dot value, then for a few hundred pounds more they&rsquo;re yours along with the ability to integrate with a RIP calibration tool or a spreadsheet.</p> <p>Foster knows his stuff about what users want, having sold 1,000 of the EasyDot&rsquo;s predecessor&rsquo;s the CCDot to UK printers. Centurfax sold the rights to the CCDot to X-Rite, which in time shifted its focus to its ICPlate product, based on a rival design from Viptronic, which it had acquired.</p> <p>Not that there was anything wrong with the CCDot. Foster reckons at least half the machines he sold are still in regular use and he still gets approached by customers who want to get their machines calibrated or repaired.</p> <p>"Units that are 10 or more years old are still working fine and if they are you wouldn&rsquo;t want to change them," he says. But, with a design that is a dozen years old, it&rsquo;s getting harder to source the components for repairs and it may get to a point where it&rsquo;s more cost-effective to buy a new unit, rather than repeatedly patching up an old faithful.</p> <p>Aside from replacements, there are also those wishing to buy their first dotmeters. Believe it or not, some firms in the UK are still making their first move to CTP and so purchasing there first dotmeter is a necessary move.</p> <p>Prior to the digitisation of reproduction, including the adoption of CTP and ICC-based colour management, the industry was happy to measure the film made on imagesetters to control the imaging process from file to plate and the all important RIP curves. You got your dot gain right, you ran to density and that was good enough.</p> <p>&nbsp;</p> <p><strong>Fooling the eye</strong></p> <p>The principle of halftoning an image &ndash; regardless of whether it is AM or FM screened, is to fool the eye into seeing different tints depending on how much of the substrate is covered in ink. Massively oversimplified, if half the paper is covered (a 50% tint) then you get a mid-tone density.</p> <p>In a simple example, some clever maths called the Murray/Davies and Yule-Nielson equations could use a density <br /> reading and, based on knowing the film base or paper <br /> density and the D max for the ink or film, you could calculate a dot percentage.</p> <p>However, with a rough grained plate with a grey metallic tint and whatever colour of image bearing emulsion, it got more complicated. Therefore, when digital plates came along, just about the same time as digital cameras did, several clever firms, including Centurfax and LMA, saw the potential of using a very specialised camera to photograph the surface of the plate and analyse the actual area covered in dot, rather than determine a fudged reading from the density and some clever maths.</p> <p>The need to control dot gain never disappeared and so the need to measure actual dots on plate remained. Even so, the adoption of thermal plates, and latterly no-process plates, meant many firms assumed it wasn&rsquo;t necessary to keep tight control on the platemaking process. For Foster, that was never the case and now there are two compelling reasons to get back into the habit of measuring plates.</p> <p>One is the adoption of ISO 12647-2, which is making a tight grip on your density and dot gain, or if you prefer the more modern term, tone value increase (TVI), a necessity. The other is the demand to be ever more efficient.</p> <p>"With ISO 12647-2 you have got to check your plates," says Foster. "Although strictly speaking, you always did.</p> <p>"The problem is that people don&rsquo;t check anything and then, when there&rsquo;s a problem on press, the first assumption is it&rsquo;s the plates. The problem then is if you make a new set of plates and put them on only to find it hasn&rsquo;t fixed the issue you&rsquo;ve wasted time and money."</p> <p>He reckons that an average problem can take around two hours to troubleshoot.</p> <p>"When you ask a printer what two hours&rsquo; downtime on a press costs, that&rsquo;s the &lsquo;aha!&rsquo; moment, when they realise all it takes is a couple of jobs to get the cost of the EasyDot back," he says. "And that&rsquo;s just your time, never mind the consequence of a bad job. The least that will set you back is a reprint, the most costly outcome could be to lose a client."</p> <p>&nbsp;</p> <p><strong>Budget concerns</strong></p> <p>Even so, the grand or so to buy the EasyDot can still be hard to come by. To overcome that, Foster is in talks with a finance firm to spread the cost over a couple of years, which takes the cost down to "a couple of quid per day", and well within any firm&rsquo;s reach.</p> <p>Centurfax&rsquo; other approach to meet the needs of the budget-conscious is the MicroDot, which was launched at Ipex in May. It uses an off-the-shelf digital microscope, which plugs into a PC, and uses Centurfax software on the computer to analyse the dots.</p> <p>One of the target markets is inkjet CTP and the firm is talking to at least one plate supplier about an OEM deal. The MicroDot could be the key to the success of the inkjet CTP market argues Foster.</p> <p>"Inkjet CTP is difficult to set up without a dotmeter and before the MicroDot the dotmeter was too expensive, now I think we&rsquo;ve got the pricing right."</p> <p>If you&rsquo;re new to CTP, looking to get a better handle on your process control, or a faithful user of an older unit that has seen better days, Centurfax and Ripware have the gadgets to keep your plates in check.</p> <hr /> <strong>SPECIFICATIONS</strong><br /> <div> <p class="SpecSansBox-Text"><strong>Media </strong><br /> Film and litho plates</p> <p class="SpecSansBox-Text"><strong>Repeatability </strong><br /> +/- 1%</p> <p class="SpecSansBox-Text"><strong>Resolution </strong><br /> 65-300lpi, 6 micron FM</p> <p class="SpecSansBox-Text"><strong>Options </strong><br /> PC connection and analysis software</p> <p class="SpecSansBox-Text"><strong>Price </strong><br /> &pound;995 or &pound;1,295 for EasyDot and software</p> </div> <p class="SpecSansBox-Text"><strong>Contact </strong><br /> Ripware 01483 578618 www.ripware.co.uk</p> <hr /> <strong>THE ALTERNATIVES</strong> <p>&nbsp;</p> <p class="ALT-Head"><strong>Centurfax MicroDot</strong></p> <p class="SansText-Fullout">Aimed at budget-conscious users &ndash; especially those using inkjet printers to output plates &ndash; the MicroDot uses an off-the-shelf digital microscope to make the readings and is connected to a PC running Centurfax software.</p> <div> <p class="ALT-Ruled"><strong>Media</strong>&nbsp; Film, plate and paper</p> <p class="ALT-Ruled"><strong>Repeatability</strong>&nbsp; n/s</p> <p class="ALT-Ruled"><strong>Resolution</strong>&nbsp; n/s</p> <p class="ALT-Ruled"><strong>Price </strong>&pound;499</p> <p class="ALT-Ruled"><strong>Contact </strong>Ripware 01483 578618 www.ripware.co.uk</p> </div> <p class="SansText-Fullout">&nbsp;</p> <p class="ALT-Head"><strong>Laurie Mullaney Associates ScreenReader</strong></p> <p class="SansText-Fullout">The ScreenReader can handle low-contrast materials, in particular digital screens for screenprint. It can also handle litho plates and LMA is working on low-contrast processless litho plates and flexo too.</p> <div> <p class="ALT-Ruled"><strong>Media </strong>Film, litho plates, screenprint stencils</p> <p class="ALT-Ruled"><strong>Repeatability</strong>&nbsp; n/s</p> <p class="ALT-Ruled"><strong>Resolution</strong> from 6 microns</p> <p class="ALT-Ruled"><strong>Price</strong> &pound;1,000 for ScreenReader and light source</p> <p class="ALT-Ruled"><strong>Contact</strong>&nbsp; Laurie Mullaney Associates 07785 272990 laurie@oneservice.co.uk</p> </div> <p class="SansText-Fullout">&nbsp;</p> <p class="ALT-Head"><strong>Techkon SpectroPlate</strong></p> <p class="SansText-Fullout">Available in three versions: the Start model offers dot value, screen angle and frequency; the Expert version adds dot gain transfer curves, geometric analysis and can store 100 readings; and the All-Vision version is the Expert vision with the added ability to measure low-contrast processless plates.</p> <div> <p class="ALT-Ruled"><strong>Media</strong> Film, plates and paper</p> <p class="ALT-Ruled"><strong>Repeatability</strong>&nbsp; +/- 0.5%</p> <p class="ALT-Ruled"><strong>Resolution</strong> 75-380lpi 10 micron FM</p> <p class="ALT-Ruled"><strong>Price </strong>on application</p> <p class="ALT-Ruled"><strong>Contact</strong> Image2Output 01707 282710 www.image2output.com</p> </div> <p class="SansText-Fullout">&nbsp;</p> <p class="ALT-Head"><strong>Troika Systems LithoCam II</strong></p> <p class="SansText-Fullout">The basic LithoCam II Lite is the nearest alternative to the EasyDot with basic dot value reporting on film and plate, although it relies on a PC connection for power and processing.&nbsp;</p> <div> <p class="ALT-Ruled"><strong>Media</strong> Film, plate and paper</p> <p class="ALT-Ruled"><strong>Repeatability</strong> +/- 0.5%</p> <p class="ALT-Ruled"><strong>Resolution</strong>100-300lpi FM 10 micron</p> <p class="ALT-Ruled"><strong>Price</strong> LithoCam II &pound;1,500; LithoCam II Lite &pound;950</p> <p class="ALT-Ruled"><strong>Contact&nbsp;</strong> Troika Systems 01793 766355 www.troika-systems.com</p> <p class="ALT-Ruled">&nbsp;</p> </div> <p class="ALT-Head"><strong>X-Rite iCPlate2</strong></p> <p class="SansText-Fullout">Measures standard plates, high-contrast processless plates and with a special cleaner, can read Fuji Pro-T. Based on the Viptronic's technology acquired by X-Rite, ICPlate2 is available in two versions the basic X and the XT.</p> <div> <p class="ALT-Ruled"><strong>Media</strong> Plates</p> <p class="ALT-Ruled"><strong>Repeatability</strong> +/- 0.5%</p> <p class="ALT-Ruled"><strong>Resolution</strong>&nbsp; 68-380lpi 10micron FM</p> <p class="ALT-Ruled"><strong>Price</strong>&nbsp; iCPlate 2 X &pound;1,500; iCPlate 2 XT &pound;2,300</p> <p class="ALT-Ruled"><strong>Contact</strong> X-Rite UK 01625 871100 www.xrite.com</p> </div> <p>&nbsp;</p> 1938933 [empty string] [empty string] [empty string] 2010-08-04 15:53:35.0 2310 Business 3DA85847-0F3E-D095-86FA75EE20BD628C.jpg 3DA83A7E-9EBE-994A-3954CCD6DDBA6E99.jpg 5 2010-08-06 00:00:00.0 1130 [empty string] [empty string] [empty string] 1 PRN [empty string] [empty string] [empty string] jon severs via CMS 3 806 2010-08-04 16:12:00.0 en_GB PrintWeek [empty string] [empty string] [empty string] [empty string] [empty string] [empty string] 0 0 0 0 [empty string] 0 [empty string] 0 [empty string] [empty string] 1020522 Business [empty string] 0.00944863384119 1 294 Product of the Week Created via the CMS4 by jon severs 0 [empty string] 2010-08-04 15:53:35.0 [empty string] 7 6151 Product of the Week [empty string] [empty string] [empty string] [empty string] [empty string] Centurfax-EasyDot 1 With ISO 12647-2 proving popular and the need to find efficiency savings still growing, Barney Cox finds that this dotmeter could have a big market [empty string] Centurfax EasyDot [empty string] [empty string] [empty string] ARTICLE:Centurfax+EasyDot:1020522
8 2010-08-06 08:00:00.0 20100806 [empty string] [empty string] [empty string] Nosmot Gbadamosi 3166 [empty string] <hr /> Inca came relatively late to the digital press game and, as a result, its rivals had the upper hand in terms of product portfolios by offering lower-cost, entry-level machines compared to Inca&rsquo;s Eagle and Columbia presses. The company decided to tackle this gap by launching the Spyder 320 at Fespa 2005 . <br /><br />"Our machines were around &pound;300,000-&pound;350,000, while other manufacturers had machines on the market at around the &pound;200,000 mark," explains Heather Kendle, Inca Digital&rsquo;s director of marketing. "The Turbo had a speed of 160m2 per hour, so they were offering high productivity. However, this was reflected in the price point." <br /><br />In comparison, the Spyder 320 runs at 80m2 per minute, dropping to 50m2 per minute in production mode. <br /><br /><strong>Constant updates</strong><br />On its launch, the press went up against the likes of Gandi units, the early versions of the Durst Rho and the Vutek QS. Since then, frequent small changes have been made to keep it up to date and current. <br /><br />For example, while the 320 started life as a four-colour-machine, it can now print in up to eight colours &ndash; in 2006, the manufacturer added the option of printing white and in 2007 the other three colours were added. The machine also went from a carriage format with one block of printheads, to being modular machine.<br /><br />"If someone buys an old four-colour machine then they can pay to have it upgraded to a six-colour, depending on the serial number of the machine," says Kendle. <br /><br />Having a modular printhead gave more flexibility to customers and meant that the replaceable unit offered a quicker changeover for colours. As for speed, Kendle says there is little difference between the early 320s and later models. <br /><br /><strong>Custom-built</strong><br />Kendle is keen to point out that the machines have always been application-led.<br /><br />"We&rsquo;ve never gone down the hybrid route. We build our machines specific to the application, so we have dedicated flatbed printers," she says.<br /><br />The latest addition to the 320 range is the Spyder 320 Q, launched at Fespa 2007. Designed for high-quality application, it features a new printhead that prints using a 10-picolitre drop at speeds up to 37m2 per hour.<br /><br />A new machine will cost up to &pound;200,000 installed and supported, while a used press installed and brought up to the latest specification will be 50% of the current new price. <br /><br />Recently, the 320 has increased sales in Brazil. This is a growing market as printers in that country are starting to build their digital business. <br /><br />"When refurbished, we will change the printheads, and look at what else needs doing to it," says Kendle. <br />Inca does not sell used machinery direct, but secondhand models can be sourced through its UK distributor, Fujifilm. <br /><br />When buying a used press from a dealer, Kendle suggests checking with Inca when the machine was last serviced and whether it is up to date technically. She adds that you should always check the printheads on any used digital printer. <hr /> <br /><strong>Specifications</strong><br /><strong>Speed </strong><br />Poster application: 80m2/hr<br />Spyder 320-e: 40m2/hr<br /><strong>Resolution </strong>600- 1,000dpi<br /><strong>Max print size </strong>3.2x1.6m<br /><strong>Weigh</strong>t 2.5 tonnes<br /><strong>Footprint</strong><br />Four-colour machine: 3.2x4.7m<br /><strong>Price</strong><br />New: up to &pound;200,000<br />Used: around &pound;100,000<br /><strong>What to look for</strong><br />Audit test<br />Service history 1938933 [empty string] [empty string] [empty string] 2010-08-04 15:18:14.0 2310 Business 3D7A4E6B-F614-6CFA-CFEC22EB79A576CC.jpg 3D7A1D69-C9BB-52F3-9178852E82BC31E1.jpg 5 2010-08-06 00:00:00.0 1130 [empty string] [empty string] [empty string] 1 PRN [empty string] [empty string] [empty string] jon severs via CMS 3 806 2010-08-04 15:33:00.0 en_GB PrintWeek [empty string] [empty string] [empty string] [empty string] [empty string] [empty string] 0 0 0 0 [empty string] 0 [empty string] 0 [empty string] [empty string] 1020509 Business [empty string] 0.00944863384119 1 296 Tried & Tested Created via the CMS4 by jon severs 0 [empty string] 2010-08-04 15:18:14.0 [empty string] 8 6154 Tried & Tested [empty string] [empty string] [empty string] [empty string] [empty string] Inca-Spyder-320 1 This was the firm's first mid-range digital press and, since its launch, updates have ensured it remains relevant, finds Nosmot Gbadamosi [empty string] Inca Spyder 320 [empty string] [empty string] [empty string] ARTICLE:Inca+Spyder+320:1020509
9 2010-07-30 08:00:00.0 20100730 [empty string] [empty string] [empty string] Adam Hooker 3163 [empty string] <hr /> <p>Print is always moving, never more so than in the current climate where run lengths are rapidly coming down, and levels of personalisation are rapidly going up. It seems as if we are heading towards a point where each individual piece of print is completely different from the next. For manufacturers, this push means that there is always something more that printers want, something different around the corner.</p> <p>Mailing equipment manufacturer Pitney Bowes believes it has come up with something different with its latest enveloping line, which it says "isn&rsquo;t just an enveloping line".</p> <p>The WrapStar range, which features the WrapStar 20 and the WrapStar 30, is designed to produce highly personalised mail at breakneck speeds &ndash; 20,000 and 30,000 cycles per hour (cph) respectively. Although it fits into the enveloping sector, the machines are actually paper wrappers, creating envelope-like products from a continuous roll, which can produce a fully personalised mail piece.</p> <p><strong>Emerging threat</strong></p> <p>Paper wrapping has been around for many years, but it has never been considered a major threat to the traditional envelope manufacturing and inserting sectors because the quality has never been quite high enough. However, full-colour ink jetting on wraps, which has subsequently opened up the ability to offer highly personalised wraps, has driven the interest in a more advanced wrapper.</p> <p>Other manufacturers have paper wrappers, but according to Pitney Bowes&rsquo; product marketing manager for document messaging technologies Simon Illingworth, these machines do not have the technology to track the mail piece or to seal it in a controlled manner &ndash; attributes he says the WrapStar can offer. As a result, the Warpstar is being branded as a new technology, rather than just another wrapping machine.</p> <p>"The overall size of the wrap for a given content is the smallest possible due to patented gluing and cutting methods," explains Illingworth.</p> <p><strong>Building blocks</strong></p> <p>The machines are based on existing technology, which was derived from the inserting and polywrapping industries. Pitney Bowes has enhanced and refined those technologies so the range produces something very similar to an envelope. Indeed, the technology now exists to create windows and cut the flap on the wrap so that it actually resembles a traditional envelope.</p> <p>Illingworth says that machines of this ilk have been particularly sought after in emerging markets, where the benefits of traditional envelopes are seen as obsolete. In the more traditional printing hotbeds, the desire for space saving is a major factor.</p> <p>At first glance, the machines act in a similar way to an envelope inserting line. Conventional continuous or cut-sheet documents are fed through an inserter onto the chassis of the machine. But then something different occurs. On the chassis, the initial document is combined with insert material. Instead of inserting this into an envelope, it is wrapped in a continuous paper wrap and then cut into individual envelopes. Illingworth says that this all takes place in one seamless operation.</p> <p>WrapStar is a pretty versatile machine capable of handing a wide range of sizes from a minimum 80x100mm right up to 250x330mm. In terms of sheets in an envelope, you&rsquo;re looking at a maximum thickness of 20mm.</p> <p>Officially launched at this year&rsquo;s Ipex exhibition, the machine is ready to ship now and Illingworth is hopeful that WrapStar will prove popular.</p> <p>"We expect to sell several in 2010, with growth in sales as the market becomes aware of the advantages of wrapping versus envelopes," says Illingworth.</p> <p>The rapid growth of transactional mail presents huge scope for sales of the machine, especially, says Illingworth, if combined with additional Pitney Bowes technology such as its new HP partnered Intellijet system.</p> <p>"The machine can use the three-up capability of the Intellijet 30 to produce the wrap and contents at the same time," he explains.</p> <p><strong>Clear advantages</strong></p> <p>Some of the main advantages of the machine are obvious to any mailing company that has a warehouse choc-full of envelopes. Alongside that you also have the benefit of not having to pay for fully produced envelopes, which should bring cost savings, as well as eradicating the need to change from one envelope to another when you move to a new job.</p> <p>For designers and other print customers, it could also offer a raft of new opportunities. For example, producing 50 envelopes in the shape of a Toy Story 3 character for a very specific mailshot could be a costly process, but if it can be wrapped around the mailout as it is brought together then time and money becomes less of an issue.</p> <p>In addition to the creative possibilities, part of the company&rsquo;s sales pitch will focus on the economical benefits that the range offers over a traditional envelope inserter. Illingworth points out that the WrapStar has "no envelope inventory, no envelope change over time and lower material cost".</p> <p>It sounds like a compelling argument and it&rsquo;s going to have to be given the machine&rsquo;s price tag of &pound;250,000. To some, this might be seen as being cost prohibitive (all of the alternatives that cited a price come in significantly cheaper than the WrapStar), but Illingworth claims that Pitney Bowes&rsquo; offer is comparable to other paper inserting lines on the market.</p> <p>"The machine&rsquo;s speed is comparable to conventional inserting machines, but among its advantages is a low cost per mail piece," adds Illingworth.</p> <p>Regardless of the price, with areas such as transactional mail growing rapidly and little signs of the speed of take-up abating, it looks as if the company has pitched a machine into the market at the right time. WrapStar has huge potential scope but its main challenge will be persuading cash-strapped business to splash out when finance is hard to find.</p> <hr /> <strong>SPECIFICATIONS<br /></strong> <p>&nbsp;</p> <div> <p class="SpecSansBox-Text"><strong>Speed </strong><br /> WrapStar 20: <br /> 20,000 pieces per hour<br /> WrapStar 30: <br /> 30,000 pieces per hour</p> <p class="SpecSansBox-Text"><strong>Envelope size</strong><br /> Min: 80x100mm<br /> Max: 250x330mm</p> <p class="SpecSansBox-Text"><strong>Max envelope thickness</strong><br /> 20mm</p> <p class="SpecSansBox-Text"><strong>Price</strong> <br /> from &pound;250,000</p> </div> <p class="SpecSansBox-Text"><strong>Contact</strong><br /> Pitney Bowes 08905 252 525 www.pitneybowes.co.uk</p> <hr /> <strong>THE ALTERNATIVES<br /></strong> <p>&nbsp;</p> <p><strong>Buhrs BB300</strong></p> <p>The BB30 envelope inserter can handle special formats such as square or creative envelopes, as well as envelopes with multiple windows. Users can not only process standard projects, but also very specific enveloping requests, even if that means adding CDs or product samples to your mailing.</p> <div> <p><strong>Max speed </strong>10,000 envelopes per hour</p> <p><strong>Price</strong> from &pound;105,000</p> <p><strong>Contact</strong> Buhrs UK 01256 329191 www.buhrs.com</p> </div> <p>&nbsp;</p> <p><strong>Sitma C80/750</strong></p> <p>Sitma&rsquo;s polywrapping line is strictly speaking a plastic wrapping line. However, it does come with a paper wrapping line as an optional extra.</p> <div> <p><strong>Max speed</strong> 12,000-15,000 packs per hour</p> <p><strong>Price</strong> &pound;20,000-&pound;100,000</p> <p><strong>Contact</strong> Integra 01420 593680 www.igm-group.co.uk</p> </div> <p>&nbsp;</p> <p><strong>Kern 2500 Multimailer</strong></p> <p>As well as having pacy high-end machines, Kern&rsquo;s mid-range products are fairly flexible. This machine can accommodate up to 28 feed stations.</p> <div> <p><strong>Max speed</strong>12,000 packs per hour</p> <p><strong>Price</strong> n/s</p> <p><strong>Contact</strong> Kern UK 01489 564141 www.kern.co.uk</p> </div> <p>&nbsp;</p> <p><strong>Muller 6800</strong></p> <p>The 6800 can accept input as: reels, which are sheeted and slit, or as sheets; fold or leave flat; accumulate documents up to 6.5mm bundle height and insert into pre-formed envelopes. As Muller design modular machines, there is no maximum feed stations.</p> <div> <p><strong>Max speed</strong>&nbsp; 15,000 packs per hour</p> <p><strong>Price</strong> from &pound;64,000</p> </div> <p><strong>Contact</strong>&nbsp; Mailing &amp; Mechanisation (UK) 01327 315031 www.mailingandmech.com</p> 1938597 [empty string] [empty string] [empty string] 2010-07-28 14:42:02.0 2310 Business 194B625E-A457-221A-0C2014664C0A5E6A.jpg 194B466F-DCCA-5081-2B91B7D2CB6F2A50.jpg 5 2010-07-30 00:00:00.0 1126 [empty string] [empty string] [empty string] 1 PRN [empty string] [empty string] [empty string] Barney Cox 1065 2010-08-02 15:41:00.0 en_GB PrintWeek [empty string] [empty string] [empty string] [empty string] [empty string] [empty string] 0 0 0 0 [empty string] 0 [empty string] 0 [empty string] [empty string] 1019161 Business [empty string] 0.00944699647622 1 294 Product of the Week Created via the CMS4 by jon severs 0 [empty string] 2010-07-28 14:42:03.0 [empty string] 9 6151 Product of the Week [empty string] [empty string] [empty string] [empty string] [empty string] Pitney-Bowes-WrapStar 1 Wrapping used to be the poor cousin of the envelopes market, but Adam Hooker says its quality has improved and this machine is part of the move towards it becoming a credible alternative [empty string] Pitney Bowes WrapStar [empty string] [empty string] [empty string] ARTICLE:Pitney+Bowes+WrapStar:1019161
10 2010-07-30 08:00:00.0 20100730 [empty string] [empty string] [empty string] Nosmot Gbadamosi 3166 [empty string] <hr /> In the late 1980s, Manroland hit upon the idea of manufacturing a compact press that could incorporate the same features as its larger, beefier machines. The upshot of this brainstorm was the Roland 200. More than 20 years later, the small press with the big ambition is still in production. <br /><br />A major attraction of the new machine was its size. Because the B2 press had a built-in delivery, it was able to offer a smaller footprint of 5.4m by 2.9m for a typical four-colour press and a maximum output of 12,000 sheets per hour (sph), so it was clearly aimed at the high-end market. <br /><br />According to Adam Robotham, commercial sales manager at Manroland UK, the machine also offered greater flexibility on substrates &ndash; it could handle a wide range of stock thickness from 0.04mm up to 0.8mm. "No other competitor offered 0.8mm in that format," claims Robotham. <br /><br />As a result the Roland 200 could handle a wider range of applications such as printing on to board. Robotham points out that the double-diameter impression cylinders and transferters used on the machine are important for printing thicker sheets and are the same used on Manroland&rsquo;s larger format presses.<br /><br /><strong>Optional extras</strong><br />The Roland 200 has a remote-controlled inking colour-control system integrated in the delivery and an automatic plate-changing system offered as an optional extra. Other options include Manroland&rsquo;s ColorPilot colour control system, an electronic double-sheet detector and an alternative basic console for the ColorPilot system. A board guide, which prevents sheets knocking against the transferters, is available as an option. It also includes a cover frame on the feedboard and sheet rear-edge guides above the impression cylinders. <br /><br />The machine can be configured with up to six units and, for presses with five or six units, options for coating, scoring and perforating are also available. For carton printing, there is an option to print full solids without gutters. <br /><br />At Drupa 2008, the manufacturer launched a high-pile delivery version, the 200 H, offering a pile height of 900mm. "We&rsquo;d noticed a demand for high-pile delivery which led to the introduction of the 200 at Drupa," explains Robotham. <br /><br />In response to customer demands, the manufacturer upgraded the 200&rsquo;s productivity to 13,000sph in 2000. And this year, developments on the machine continued with the 200 LV introduced at Ipex. The LV version offered a dedicated coating unit on four-colour models. <br /><br />More than 20 years after the original model was launched, the 200 remains popular today, according to Robotham. "The used market is quite strong for the 200. People like it because of the flexibility in the variety of substrates it can handle," he says. <br /><br />In addition to interest from the UK, India and China, South America promises to be a buoyant market for used sheetfed presses such as the 200. <br /><br />Manroland also sells used machines. When sourcing used presses it is advisable to check for common problems such as cylinder and ink-roller damage. The manufacturer offers service contracts through its ProServ maintenance agreements. Users can choose from a basic contract up to one offering all parts and covering all service requirements. A new Roland 204 H LV costs about &pound;490,000, while a used Roland 204 made in 2005 costs around &pound;160,000. <hr /> <strong>SPECIFICATIONS<br />Printing units</strong> 2-6<br /><strong>Speed</strong> 13,000sph<br /><strong>Min sheet size</strong> 210x297mm<br /><strong>Max sheet size</strong> 520x740mm<br /><strong>Max image area</strong>&nbsp; 510x735mm<br /><strong>Stock thickness </strong> 0.04&ndash;0.8mm<br /><strong>Delivery pile height </strong> 500mm<br /><strong>Footprint</strong> 3.6x2.9m (2-colour)<br /><strong>Weight</strong> 8,800kg<br /><strong>Price</strong><br />New: 204 H LV &pound;490,000<br />Used: 2005 204 &pound;160,000<br /><strong>What to look for</strong><br />Cylinder damage<br />Rollers<br />Service history<br /> 1938597 [empty string] [empty string] [empty string] 2010-07-28 14:18:31.0 2310 Business 1935B7E3-EF24-E984-632F6EBFBDB74B4F.jpg 193590EC-D0F9-DC37-B6C6996F01C9EC98.jpg 5 2010-07-30 00:00:00.0 1126 [empty string] [empty string] [empty string] 1 PRN [empty string] [empty string] [empty string] Chloe Setter 911 2010-07-30 11:02:00.0 en_GB PrintWeek [empty string] [empty string] [empty string] [empty string] [empty string] [empty string] 0 0 0 0 [empty string] 0 [empty string] 0 [empty string] [empty string] 1019153 Business [empty string] 0.00944699647622 1 296 Tried & Tested Created via the CMS4 by jon severs 0 [empty string] 2010-07-28 14:18:31.0 [empty string] 10 6154 Tried & Tested [empty string] [empty string] [empty string] [empty string] [empty string] Manroland-200 1 Manroland's 200 range of compact presses has become a driving force in the market by offering flexibility and power, writes Nosmot Gbadamosi [empty string] Manroland 200 [empty string] [empty string] [empty string] ARTICLE:Manroland+200:1019153